PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100158510121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 467aa    MW: 51298 Da    PI: 5.6425
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100158510121genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085.2e-34263317155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Ote100158510121|100158510121 263 KQRMRWTPELHETFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 317
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.521260320IPR017930Myb domain
SuperFamilySSF466894.3E-18261317IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-31262319IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-25263317IPR006447Myb domain, plants
PfamPF002491.9E-10265316IPR001005SANT/Myb domain
PfamPF143797.9E-26348395IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MEAKHALPIQ RSGPRQISNL GASASISASF PVPPTALEET YPRFSESQQV SVEREVMHRP  60
PAVVSSQSSN SGAVGPIFSS SSGFSTDLHF SSIQHQEKHP RESPFISQSS SSGKSVRLPH  120
SVDSQVLQST ASSHFNKENN DSWCADTLPD FLDFPMSTTI QSSQLYGSNS SGITIPQEDL  180
GKPNDWQDWA DQLITDNDAL TADWSGLLAD ASVGDPEPKV EISQQCTNIS QQQFHIPQQQ  240
LPRTPGEICT TGAQSSSNAA PAKQRMRWTP ELHETFVEAV NKLGGSERAT PKGVLKLMKV  300
EGLTIYHVKS HLQKYRTARY KPETTEESSE LKSASIEELS SLDLKTGIEI TEALRLQMEV  360
QKRLHEQLEI QRNLQLRIEE QGRYLQMMFE KQCKSGMESV KGASSSSEKV LTDVQNSTSK  420
ENSVAEAEKN NTEGEPSSMA KKTRETCPVA AVPQGSSPPA KRAKIDE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080098.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLA0A022S2540.0A0A022S254_ERYGU; Uncharacterized protein
STRINGPOPTR_0002s25960.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349